PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G11050.1
Common NameAtMYB64, MYB64, T5K6_40, URP10
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 423aa    MW: 48085.8 Da    PI: 7.384
Description myb domain protein 64
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G11050.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.8e-17105151148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT++Ed +l+++v q+G + W+ I++++  gR +kqc++rw+++l
      AT5G11050.1 105 KGQWTADEDRKLIKLVMQHGERKWAVISEKLE-GRAGKQCRERWHNHL 151
                      799*****************************.*************97 PP

2Myb_DNA-binding55.61.3e-17157199145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W++eE+ llv+a+++ G++ W+ Ia+ ++ gRt++++k++w+
      AT5G11050.1 157 KDSWSEEEERLLVEAHTRIGNK-WAEIAKLIQ-GRTENSIKNHWN 199
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.065100155IPR017930Myb domain
SuperFamilySSF466891.04E-28102198IPR009057Homeodomain-like
SMARTSM007176.8E-16104153IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-26106158IPR009057Homeodomain-like
CDDcd001671.24E-13108151No hitNo description
PfamPF139215.7E-19108168No hitNo description
PROSITE profilePS5129419.813156206IPR017930Myb domain
SMARTSM007171.1E-14156204IPR001005SANT/Myb domain
CDDcd001672.39E-10159202No hitNo description
Gene3DG3DSA:1.10.10.603.5E-20159204IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0030154Biological Processcell differentiation
GO:0051302Biological Processregulation of cell division
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0020094anatomyplant egg cell
PO:0025074anatomyembryo sac
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MEEQKIQEKS LAHGAAPPLT AVERFLNGQK NEALCFKKQE RSIDRPIVKT TRAIEIRNEN  60
KENMMFGPRK EKNLAVIGEI VVKGAAKDYT CKDITKKQPY KNIIKGQWTA DEDRKLIKLV  120
MQHGERKWAV ISEKLEGRAG KQCRERWHNH LRPDIKKDSW SEEEERLLVE AHTRIGNKWA  180
EIAKLIQGRT ENSIKNHWNA TKRRQNSKRK HKRSKNADSN SDIDDLSPSA KRPRILEDYI  240
KNIENNDKNN GENIMTTSGN NVLSTSNYDQ FNSEDSTSSL LDDPYDEELV FLKNIFENHS  300
LENINLSQGT EITQSSSSGF MIENPKPKPN LYNNTFGTHL GAMVTEPANS SHLASDIYLS  360
DLLNGTASSS SSLTFLSSNN NEHAGENELL LPQANSTSER REMDLIEMLS GSTQGSNIWF  420
PLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-441032052104C-Myb DNA-Binding Domain
1msf_C1e-441032052104C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201212KRRQNSKRKHKR
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible245847_at0.0
Expression AtlasAT5G11050-
AtGenExpressAT5G11050-
ATTED-IIAT5G11050-
Functional Description ? help Back to Top
Source Description
TAIRMember of R2R3-MYB transcription factor gene family.
Function -- GeneRIF ? help Back to Top
  1. MYB64 and MYB119 are expressed during the FG5 transition, and most myb64 myb119 double mutant gametophytes fail to initiate the FG5 transition, resulting in uncellularized gametophytes with supernumerary nuclei
    [PMID: 24068955]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G11050.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G11050
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196200.0AY519620.1 Arabidopsis thaliana MYB transcription factor (At5g11050) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_196666.10.0myb domain protein 64
TrEMBLQ9FY600.0Q9FY60_ARATH; MYB DNA-binding-like protein
STRINGAT5G11050.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42652656
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Johnston AJ, et al.
    Genetic subtraction profiling identifies genes essential for Arabidopsis reproduction and reveals interaction between the female gametophyte and the maternal sporophyte.
    Genome Biol., 2007. 8(10): p. R204
    [PMID:17915010]
  5. Wuest SE, et al.
    Arabidopsis female gametophyte gene expression map reveals similarities between plant and animal gametes.
    Curr. Biol., 2010. 20(6): p. 506-12
    [PMID:20226671]
  6. Waki T, et al.
    A GAL4-based targeted activation tagging system in Arabidopsis thaliana.
    Plant J., 2013. 73(3): p. 357-67
    [PMID:23057675]
  7. Rabiger DS,Drews GN
    MYB64 and MYB119 are required for cellularization and differentiation during female gametogenesis in Arabidopsis thaliana.
    PLoS Genet., 2013. 9(9): p. e1003783
    [PMID:24068955]